PPIL3 (NM_130906) Human Recombinant Protein

SKU TP302546

Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 3 (PPIL3), transcript variant PPIL3b, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202546 protein sequence; Red=Cloning site Green=Tags(s); ; MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKK; FEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT; YRPLNEVHIKDITIHANPFAQ; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 18 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_570981
• Locus ID: 53938
• UniProt ID: Q9H2H8
• Cytogenetics: 2q33.1
• RefSeq Size: 1179
• RefSeq ORF: 483
• Synonyms: CYPJ
• Summary: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2008]