PPIL3 (NM_131916) Human Mass Spec Standard

SKU PH317389

PPIL3 MS Standard C13 and N15-labeled recombinant protein (NP_572028)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC217389]
• Predicted MW: 18.2 kDa
• Protein Sequence:
  Protein Sequence

  >RC217389 protein sequence; Red=Cloning site Green=Tags(s); ; MSVTLHTDVGDIKIEVFCERTPKTCENFLALCASNYYNGCIFHRNIKGFMVQTGDPTGTGRGGNSIWGKK; FEDEYSEYLKHNVRGVVSMANNGPNTNGSQFFITYGKQPHLDMKYTVFGKVIDGLETLDELEKLPVNEKT; YRPLNEVHIKDITIHANPFAQ; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_572028
• RefSeq Size: 1620
• RefSeq ORF: 483
• Synonyms: cyclophilin-like protein 3; cyclophilin J; CYPJ; peptidylprolyl cis-trans isomerase-like protein 3; peptidylprolyl isomerase (cyclophilin)-like 3; peptidylprolyl isomerase-like 3; PPIase-like protein 3
• Locus ID: 53938
• UniProt ID: Q9H2H8
• Cytogenetics: 2q33.1
• Summary: This gene encodes a member of the cyclophilin family. Cyclophilins catalyze the cis-trans isomerization of peptidylprolyl imide bonds in oligopeptides. They have been proposed to act either as catalysts or as molecular chaperones in protein-folding events. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2008]