START domain containing 7 (STARD7) (NM_020151) Human Recombinant Protein

SKU
TP302539
Recombinant protein of human StAR-related lipid transfer (START) domain containing 7 (STARD7), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202539 protein sequence
Red=Cloning site Green=Tags(s)

MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVM
DKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHW
VTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFD
YLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSE
RKNEGSCGPARIEYA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 42.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_064536
Locus ID 56910
UniProt ID Q9NQZ5
Cytogenetics 2q11.2
RefSeq Size 3394
RefSeq ORF 885
Synonyms FAME2; GTT1
Summary May play a protective role in mucosal tissues by preventing exaggerated allergic responses.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:START domain containing 7 (STARD7) (NM_020151) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302539 STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_064536) 10 ug
$3,255.00
PH303423 STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_644672) 10 ug
$3,255.00
LC408330 STARD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412634 STARD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408330 Transient overexpression lysate of START domain containing 7 (STARD7), transcript variant 2 100 ug
$436.00
LY412634 Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 7 (STARD7) 100 ug
$436.00
TP303423 Recombinant protein of human START domain containing 7 (STARD7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.