START domain containing 7 (STARD7) (NM_020151) Human Mass Spec Standard

SKU
PH302539
STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_064536)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202539]
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC202539 protein sequence
Red=Cloning site Green=Tags(s)

MAALAGVFVWDEERIQEEELQRSINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVM
DKKHFKLWRRPITGTHLYQYRVFGTYTDVTPRQFFNVQLDTEYRKKWDALVIKLEVIERDVVSGSEVLHW
VTHFPYPMYSRDYVYVRRYSVDQENNMMVLVSRAVEHPSVPESPEFVRVRSYESQMVIRPHKSFDENGFD
YLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSE
RKNEGSCGPARIEYA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_064536
RefSeq Size 3394
RefSeq ORF 885
Synonyms FAME2; GTT1
Locus ID 56910
UniProt ID Q9NQZ5
Cytogenetics 2q11.2
Summary May play a protective role in mucosal tissues by preventing exaggerated allergic responses.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:START domain containing 7 (STARD7) (NM_020151) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH303423 STARD7 MS Standard C13 and N15-labeled recombinant protein (NP_644672) 10 ug
$3,255.00
LC408330 STARD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC412634 STARD7 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY408330 Transient overexpression lysate of START domain containing 7 (STARD7), transcript variant 2 100 ug
$436.00
LY412634 Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 7 (STARD7) 100 ug
$436.00
TP302539 Recombinant protein of human StAR-related lipid transfer (START) domain containing 7 (STARD7), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP303423 Recombinant protein of human START domain containing 7 (STARD7), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.