Uteroglobin (SCGB1A1) (NM_003357) Human Recombinant Protein

SKU
TP302497
Recombinant protein of human secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202497 protein sequence
Red=Cloning site Green=Tags(s)

MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP
QKPRESIIKLMEKIAQSSLCN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 9.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003348
Locus ID 7356
UniProt ID P11684
Cytogenetics 11q12.3
RefSeq Size 452
RefSeq ORF 273
Synonyms CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1
Summary This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010]
Protein Families Druggable Genome, Secreted Protein
Write Your Own Review
You're reviewing:Uteroglobin (SCGB1A1) (NM_003357) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302497 SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348) 10 ug
$3,255.00
LC418739 SCGB1A1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418739 Transient overexpression lysate of secretoglobin, family 1A, member 1 (uteroglobin) (SCGB1A1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.