Uteroglobin (SCGB1A1) (NM_003357) Human Mass Spec Standard

SKU PH302497

SCGB1A1 MS Standard C13 and N15-labeled recombinant protein (NP_003348)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC202497]
• Predicted MW: 10 kDa
• Protein Sequence:
  Protein Sequence

  >RC202497 protein sequence; Red=Cloning site Green=Tags(s); ; MKLAVTLTLVTLALCCSSASAEICPSFQRVIETLLMDTPSSYEAAMELFSPDQDMREAGAQLKKLVDTLP; QKPRESIIKLMEKIAQSSLCN; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003348
• RefSeq Size: 452
• RefSeq ORF: 273
• Synonyms: CC10; CC16; CCPBP; CCSP; UGB; UP-1; UP1
• Locus ID: 7356
• UniProt ID: P11684
• Cytogenetics: 11q12.3
• Summary: This gene encodes a member of the secretoglobin family of small secreted proteins. The encoded protein has been implicated in numerous functions including anti-inflammation, inhibition of phospholipase A2 and the sequestering of hydrophobic ligands. Defects in this gene are associated with a susceptibility to asthma. [provided by RefSeq, May 2010]
• Protein Families: Druggable Genome, Secreted Protein