ING2 (NM_001564) Human Recombinant Protein

SKU
TP302478
Recombinant protein of human inhibitor of growth family, member 2 (ING2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202478 protein sequence
Red=Cloning site Green=Tags(s)

MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY
KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM
DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN
EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001555
Locus ID 3622
UniProt ID Q9H160
Cytogenetics 4q35.1
RefSeq Size 2465
RefSeq ORF 840
Synonyms ING1L; p33ING2
Summary This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ING2 (NM_001564) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302478 ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555) 10 ug
$3,255.00
LC419856 ING2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419856 Transient overexpression lysate of inhibitor of growth family, member 2 (ING2) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.