ING2 (NM_001564) Human Mass Spec Standard

SKU
PH302478
ING2 MS Standard C13 and N15-labeled recombinant protein (NP_001555)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202478]
Predicted MW 32.8 kDa
Protein Sequence
Protein Sequence
>RC202478 protein sequence
Red=Cloning site Green=Tags(s)

MLGQQQQQLYSSAALLTGERSRLLTCYVQDYLECVESLPHDMQRNVSVLRELDNKYQETLKEIDDVYEKY
KKEDDLNQKKRLQQLLQRALINSQELGDEKIQIVTQMLELVENRARQMELHSQCFQDPAESERASDKAKM
DSSQPERSSRRPRRQRTSESRDLCHMANGIEDCDDQPPKEKKSKSAKKKKRSKAKQEREASPVEFAIDPN
EPTYCLCNQVSYGEMIGCDNEQCPIEWFHFSCVSLTYKPKGKWYCPKCRGDNEKTMDKSTEKTKKDRRSR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001555
RefSeq Size 2465
RefSeq ORF 840
Synonyms ING1L; p33ING2
Locus ID 3622
UniProt ID Q9H160
Cytogenetics 4q35.1
Summary This gene is a member of the inhibitor of growth (ING) family. Members of the ING family associate with and modulate the activity of histone acetyltransferase (HAT) and histone deacetylase (HDAC) complexes and function in DNA repair and apoptosis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:ING2 (NM_001564) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419856 ING2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419856 Transient overexpression lysate of inhibitor of growth family, member 2 (ING2) 100 ug
$436.00
TP302478 Recombinant protein of human inhibitor of growth family, member 2 (ING2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.