Membrin (GOSR2) (NM_004287) Human Recombinant Protein

SKU
TP302175
Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202175 protein sequence
Red=Cloning site Green=Tags(s)

MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV
DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL
ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY
LT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.6 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_004278
Locus ID 9570
UniProt ID O14653
Cytogenetics 17q21.32
RefSeq Size 3319
RefSeq ORF 636
Synonyms Bos1; EPM6; GS27
Summary This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:Membrin (GOSR2) (NM_004287) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH302175 GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278) 10 ug
$3,255.00
LC409306 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418077 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422877 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409306 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B 100 ug
$436.00
LY418077 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A 100 ug
$436.00
LY422877 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.