Membrin (GOSR2) (NM_004287) Human Recombinant Protein
CAT#: TP302175
Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC202175 protein sequence
Red=Cloning site Green=Tags(s) MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY LT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 24.6 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004278 |
Locus ID | 9570 |
UniProt ID | O14653 |
Cytogenetics | 17q21.32 |
Refseq Size | 3319 |
Refseq ORF | 636 |
Synonyms | Bos1; EPM6; GS27 |
Summary | This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC409306 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC418077 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC422877 | GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY409306 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B |
USD 436.00 |
|
LY418077 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A |
USD 436.00 |
|
LY422877 | Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C |
USD 436.00 |
|
PH302175 | GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278) |
USD 3,255.00 |
{0} Product Review(s)
Be the first one to submit a review