Membrin (GOSR2) (NM_004287) Human Mass Spec Standard

SKU
PH302175
GOSR2 MS Standard C13 and N15-labeled recombinant protein (NP_004278)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC202175]
Predicted MW 24.8 kDa
Protein Sequence
Protein Sequence
>RC202175 protein sequence
Red=Cloning site Green=Tags(s)

MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV
DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL
ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY
LT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004278
RefSeq Size 3319
RefSeq ORF 636
Synonyms Bos1; EPM6; GS27
Locus ID 9570
UniProt ID O14653
Cytogenetics 17q21.32
Summary This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Write Your Own Review
You're reviewing:Membrin (GOSR2) (NM_004287) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC409306 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418077 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422877 GOSR2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY409306 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant B 100 ug
$436.00
LY418077 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant A 100 ug
$436.00
LY422877 Transient overexpression lysate of golgi SNAP receptor complex member 2 (GOSR2), transcript variant C 100 ug
$436.00
TP302175 Recombinant protein of human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.