Membrin (GOSR2) (NM_004287) Human Tagged ORF Clone

SKU
RC202175
GOSR2 (Myc-DDK-tagged)-Human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$300.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Membrin
Synonyms Bos1; EPM6; GS27
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202175 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGATCCCCTGTTCCAGCAAACGCACAAGCAGGTCCACGAGATCCAGTCTTGCATGGGACGCCTGGAGA
CGGCAGACAAGCAGTCTGTGCACATAGTAGAAAACGAAATCCAAGCAAGCATAGACCAGATATTCAGCCG
TCTAGAACGTCTGGAGATTTTGTCCAGCAAGGAGCCCCCTAACAAAAGGCAAAATGCCAGACTTCGGGTT
GACCAGTTAAAGTATGATGTCCAGCACCTGCAGACTGCGCTCAGAAACTTCCAGCATCGGCGCCATGCAA
GGGAGCAGCAGGAGAGACAGCGAGAAGAGCTTCTGTCTCGAACCTTCACCACTAACGACTCTGACACCAC
CATACCAATGGACGAATCACTGCAGTTTAACTCCTCCCTCCAGAAAGTTCACAACGGCATGGATGACCTC
ATTTTAGATGGGCACAATATTTTAGATGGACTGAGGACCCAGAGACTGACCTTGAAGGGGACTCAGAAGA
AGATCCTTGACATTGCCAACATGCTGGGCTTGTCCAACACAGTGATGCGGCTCATCGAGAAGCGGGCTTT
CCAGGACAAGTACTTTATGATAGGTGGGATGCTGCTGACCTGTGTGGTCATGTTCCTCGTGGTGCAGTAC
CTGACA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202175 protein sequence
Red=Cloning site Green=Tags(s)

MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRV
DQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDL
ILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQY
LT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_004287
ORF Size 636 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_004287.5
RefSeq Size 3319 bp
RefSeq ORF 639 bp
Locus ID 9570
UniProt ID O14653
Cytogenetics 17q21.32
Domains V-SNARE
Protein Families Druggable Genome, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
MW 24.8 kDa
Summary This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016]
Write Your Own Review
You're reviewing:Membrin (GOSR2) (NM_004287) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202175L3 Lenti ORF clone of Human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, Myc-DDK-tagged 10 ug
$600.00
RC202175L4 Lenti ORF clone of Human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A, mGFP tagged 10 ug
$600.00
RG202175 GOSR2 (tGFP-tagged) - Human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A 10 ug
$500.00
SC127331 GOSR2 (untagged)-Human golgi SNAP receptor complex member 2 (GOSR2), transcript variant A 10 ug
$300.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.