Noxa (PMAIP1) (NM_021127) Human Recombinant Protein

  • Product Brand Image
SKU
TP302071
Recombinant protein of human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), 20 µg
In Control Promo
  $867.00
In Stock*
Bulk/Customize
Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s)

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 5.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_066950
Locus ID 5366
UniProt ID Q13794
Cytogenetics 18q21.32
RefSeq Size 1885
RefSeq ORF 162
Synonyms APR; NOXA
Summary This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. provided by RefSeq, Aug 2020
Protein Categories Intracellular Proteins
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways p53 signaling pathway
Reviews
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Documents
Resources
Other "Noxa" proteins (3)
SKU Description Size Price
PH302071 PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950) 10 ug
$3,360.00
LC402842 PMAIP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402842 Transient overexpression lysate of phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) 100 ug
$436.00
OriGene AI

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.