Noxa (PMAIP1) (NM_021127) Human Recombinant Protein
SKU
TP302071
Recombinant protein of human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), 20 µg
$867.00
In Stock*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s) MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 5.8 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_066950 |
Locus ID | 5366 |
UniProt ID | Q13794 |
Cytogenetics | 18q21.32 |
RefSeq Size | 1885 |
RefSeq ORF | 162 |
Synonyms | APR; NOXA |
Summary | This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020] |
Protein Families | Druggable Genome, Stem cell - Pluripotency |
Protein Pathways | p53 signaling pathway |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH302071 | PMAIP1 MS Standard C13 and N15-labeled recombinant protein (NP_066950) | 10 ug |
$3,255.00
|
|
LC402842 | PMAIP1 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402842 | Transient overexpression lysate of phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) | 100 ug |
$436.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.