Noxa (PMAIP1) (NM_021127) Human Tagged ORF Clone

SKU
RC202071
PMAIP1 (Myc-DDK-tagged)-Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$150.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol Noxa
Synonyms APR; NOXA
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC202071 representing NM_021127
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTGGGAAGAAGGCGCGCAAGAACGCTCAACCGAGCCCCGCGCGGGCTCCAGCAGAGCTGGAAGTCG
AGTGTGCTACTCAACTCAGGAGATTTGGAGACAAACTGAACTTCCGGCAGAAACTTCTGAATCTGATATC
CAAACTCTTCTGCTCAGGAACC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC202071 representing NM_021127
Red=Cloning site Green=Tags(s)

MPGKKARKNAQPSPARAPAELEVECATQLRRFGDKLNFRQKLLNLISKLFCSGT

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_021127
ORF Size 162 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_021127.3
RefSeq Size 1885 bp
RefSeq ORF 165 bp
Locus ID 5366
UniProt ID Q13794
Cytogenetics 18q21.32
Protein Families Druggable Genome, Stem cell - Pluripotency
Protein Pathways p53 signaling pathway
MW 5.8 kDa
Summary This gene belongs to a pro-apoptotic subfamily within the BCL-2 protein family, referred to as the BCL-2 homology domain 3 (BH3)-only subfamily, which determine whether a cell commits to apoptosis. In response to death-inducing stimuli, BH3-only members inhibit the anti-apoptotic BCL-2 family members, which under steady-state conditions keep the multi-BH domain proteins BAX and BAK, in an inactive state. [provided by RefSeq, Aug 2020]
Write Your Own Review
You're reviewing:Noxa (PMAIP1) (NM_021127) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC202071L1 Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), Myc-DDK-tagged 10 ug
$450.00
RC202071L2 Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), mGFP tagged 10 ug
$450.00
RC202071L3 Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), Myc-DDK-tagged 10 ug
$450.00
RC202071L4 Lenti ORF clone of Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1), mGFP tagged 10 ug
$450.00
RG202071 PMAIP1 (tGFP-tagged) - Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) 10 ug
$489.00
SC112973 PMAIP1 (untagged)-Human phorbol-12-myristate-13-acetate-induced protein 1 (PMAIP1) 10 ug
$150.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.