PEPD (NM_000285) Human Recombinant Protein
CAT#: TP301970
Recombinant protein of human peptidase D (PEPD), 20 µg
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201970 protein sequence
Red=Cloning site Green=Tags(s) MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS GPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 54.4 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_000276 |
Locus ID | 5184 |
UniProt ID | P12955, A0A140VJR2 |
Cytogenetics | 19q13.11 |
Refseq Size | 2019 |
Refseq ORF | 1479 |
Synonyms | PROLIDASE |
Summary | This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Protease |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424818 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431373 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LC431394 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) |
USD 134.00 |
|
LY424818 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 1 |
USD 436.00 |
|
LY431373 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 3 |
USD 436.00 |
|
LY431394 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 2 |
USD 436.00 |
|
PH301970 | PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276) |
USD 3,255.00 |
|
TP721022 | Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1 |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review