PEPD (NM_000285) Human Recombinant Protein

SKU
TP301970
Recombinant protein of human peptidase D (PEPD), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201970 protein sequence
Red=Cloning site Green=Tags(s)

MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF
FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK
PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM
KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE
YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS
VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH
LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS
GPK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 54.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_000276
Locus ID 5184
UniProt ID P12955
Cytogenetics 19q13.11
RefSeq Size 2019
RefSeq ORF 1479
Synonyms PROLIDASE
Summary This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:PEPD (NM_000285) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301970 PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276) 10 ug
$3,255.00
LC424818 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431373 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431394 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424818 Transient overexpression lysate of peptidase D (PEPD), transcript variant 1 100 ug
$436.00
LY431373 Transient overexpression lysate of peptidase D (PEPD), transcript variant 3 100 ug
$436.00
LY431394 Transient overexpression lysate of peptidase D (PEPD), transcript variant 2 100 ug
$436.00
TP721022 Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.