PEPD (NM_000285) Human Mass Spec Standard

SKU
PH301970
PEPD MS Standard C13 and N15-labeled recombinant protein (NP_000276)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201970]
Predicted MW 54.5 kDa
Protein Sequence
Protein Sequence
>RC201970 protein sequence
Red=Cloning site Green=Tags(s)

MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF
FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK
PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM
KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE
YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS
VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH
LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS
GPK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000276
RefSeq Size 2019
RefSeq ORF 1479
Synonyms PROLIDASE
Locus ID 5184
UniProt ID P12955
Cytogenetics 19q13.11
Summary This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]
Protein Families Druggable Genome, Protease
Write Your Own Review
You're reviewing:PEPD (NM_000285) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424818 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431373 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431394 PEPD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424818 Transient overexpression lysate of peptidase D (PEPD), transcript variant 1 100 ug
$436.00
LY431373 Transient overexpression lysate of peptidase D (PEPD), transcript variant 3 100 ug
$436.00
LY431394 Transient overexpression lysate of peptidase D (PEPD), transcript variant 2 100 ug
$436.00
TP301970 Recombinant protein of human peptidase D (PEPD), 20 µg 20 ug
$737.00
TP721022 Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.