PEPD (NM_000285) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201970] |
Predicted MW | 54.5 kDa |
Protein Sequence |
Protein Sequence
>RC201970 protein sequence
Red=Cloning site Green=Tags(s) MAAATGPSFWLGNETLKVPLALFALNRQRLCERLRKNPAVQAGSIVVLQGGEETQRYCTDTGVLFRQESF FHWAFGVTEPGCYGVIDVDTGKSTLFVPRLPASHATWMGKIHSKEHFKEKYAVDDVQYVDEIASVLTSQK PSVLLTLRGVNTDSGSVCREASFDGISKFEVNNTILHPEIVECRVFKTDMELEVLRYTNKISSEAHREVM KAVKVGMKEYELESLFEHYCYSRGGMRHSSYTCICGSGENSAVLHYGHAGAPNDRTIQNGDMCLFDMGGE YYCFASDITCSFPANGKFTADQKAVYEAVLRSSRAVMGAMKPGVWWPDMHRLADRIHLEELAHMGILSGS VDAMVQAHLGAVFMPHGLGHFLGIDVHDVGGYPEGVERIDEPGLRSLRTARHLQPGMVLTVEPGIYFIDH LLDEALADPARASFLNREVLQRFRGFGGVRIEEDVVVTDSGIELLTCVPRTVEEIEACMAGCDKAFTPFS GPK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000276 |
RefSeq Size | 2019 |
RefSeq ORF | 1479 |
Synonyms | PROLIDASE |
Locus ID | 5184 |
UniProt ID | P12955 |
Cytogenetics | 19q13.11 |
Summary | This gene encodes a member of the peptidase family. The protein forms a homodimer that hydrolyzes dipeptides or tripeptides with C-terminal proline or hydroxyproline residues. The enzyme serves an important role in the recycling of proline, and may be rate limiting for the production of collagen. Mutations in this gene result in prolidase deficiency, which is characterized by the excretion of large amount of di- and tri-peptides containing proline. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009] |
Protein Families | Druggable Genome, Protease |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC424818 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431373 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC431394 | PEPD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY424818 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 1 | 100 ug |
$436.00
|
|
LY431373 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 3 | 100 ug |
$436.00
|
|
LY431394 | Transient overexpression lysate of peptidase D (PEPD), transcript variant 2 | 100 ug |
$436.00
|
|
TP301970 | Recombinant protein of human peptidase D (PEPD), 20 µg | 20 ug |
$737.00
|
|
TP721022 | Purified recombinant protein of Human peptidase D (PEPD), transcript variant 1 | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.