PINX1 (NM_017884) Human Recombinant Protein

SKU
TP301903
Recombinant protein of human PIN2-interacting protein 1 (PINX1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201903 protein sequence
Red=Cloning site Green=Tags(s)

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK
RGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 36.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060354
Locus ID 54984
UniProt ID Q96BK5
Cytogenetics 8p23.1
RefSeq Size 1570
RefSeq ORF 984
Synonyms Gno1; LPTL; LPTS; Pxr1
Summary Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PINX1 (NM_017884) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301903 PINX1 MS Standard C13 and N15-labeled recombinant protein (NP_060354) 10 ug
$3,255.00
LC413467 PINX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413467 Transient overexpression lysate of PIN2-interacting protein 1 (PINX1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.