PINX1 (NM_017884) Human Mass Spec Standard

SKU
PH301903
PINX1 MS Standard C13 and N15-labeled recombinant protein (NP_060354)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201903]
Predicted MW 37 kDa
Protein Sequence
Protein Sequence
>RC201903 protein sequence
Red=Cloning site Green=Tags(s)

MSMLAERRRKQKWAVDPQNTAWSNDDSKFGQRMLEKMGWSKGKGLGAQEHGATDHIKVQVKNNHLGLGAT
INNEDNWIAHQDDFNQLLAELNTCHGQETTDSSDKKEKKSFSLEEKSKISKNRVHYMKFTKGKDLSSRSK
TDLDCIFGKRQSKKTPEGDASPSTPEENETTTTSAFTIQEYFAKRMAALKNKPQVPVPGSDISETQVERK
RGKKINKEATGKDVESYLQPKAKRHTEGKPERAEAQERVAKKKSAPAEEQLRGPCWDQSSKASAQDAGDH
VQPPEGRDFTLKPKKRRGKKKLQKPVEIAEDATLEETLVKKKKKKDSK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060354
RefSeq Size 1570
RefSeq ORF 984
Synonyms Gno1; LPTL; LPTS; Pxr1
Locus ID 54984
UniProt ID Q96BK5
Cytogenetics 8p23.1
Summary Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PINX1 (NM_017884) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413467 PINX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413467 Transient overexpression lysate of PIN2-interacting protein 1 (PINX1) 100 ug
$436.00
TP301903 Recombinant protein of human PIN2-interacting protein 1 (PINX1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.