AKT1 (NM_001014431) Human Recombinant Protein

SKU
TP301850
Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 3, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201850 protein sequence
Red=Cloning site Green=Tags(s)

MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRP
NTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAK
PKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL
TALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL
MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY
NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001014431
Locus ID 207
UniProt ID P31749
Cytogenetics 14q32.33
RefSeq Size 2794
RefSeq ORF 1440
Synonyms AKT; PKB; PKB-ALPHA; PRKBA; RAC; RAC-ALPHA
Summary This gene encodes one of the three members of the human AKT serine-threonine protein kinase family which are often referred to as protein kinase B alpha, beta, and gamma. These highly similar AKT proteins all have an N-terminal pleckstrin homology domain, a serine/threonine-specific kinase domain and a C-terminal regulatory domain. These proteins are phosphorylated by phosphoinositide 3-kinase (PI3K). AKT/PI3K forms a key component of many signalling pathways that involve the binding of membrane-bound ligands such as receptor tyrosine kinases, G-protein coupled receptors, and integrin-linked kinase. These AKT proteins therefore regulate a wide variety of cellular functions including cell proliferation, survival, metabolism, and angiogenesis in both normal and malignant cells. AKT proteins are recruited to the cell membrane by phosphatidylinositol 3,4,5-trisphosphate (PIP3) after phosphorylation of phosphatidylinositol 4,5-bisphosphate (PIP2) by PI3K. Subsequent phosphorylation of both threonine residue 308 and serine residue 473 is required for full activation of the AKT1 protein encoded by this gene. Phosphorylation of additional residues also occurs, for example, in response to insulin growth factor-1 and epidermal growth factor. Protein phosphatases act as negative regulators of AKT proteins by dephosphorylating AKT or PIP3. The PI3K/AKT signalling pathway is crucial for tumor cell survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating AKT1 which then phosphorylates and inactivates components of the apoptotic machinery. AKT proteins also participate in the mammalian target of rapamycin (mTOR) signalling pathway which controls the assembly of the eukaryotic translation initiation factor 4F (eIF4E) complex and this pathway, in addition to responding to extracellular signals from growth factors and cytokines, is disregulated in many cancers. Mutations in this gene are associated with multiple types of cancer and excessive tissue growth including Proteus syndrome and Cowden syndrome 6, and breast, colorectal, and ovarian cancers. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2020]
Protein Families Druggable Genome, ES Cell Differentiation/IPS, Protein Kinase
Protein Pathways Acute myeloid leukemia, Adipocytokine signaling pathway, Apoptosis, B cell receptor signaling pathway, Chemokine signaling pathway, Chronic myeloid leukemia, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Focal adhesion, Glioma, Insulin signaling pathway, Jak-STAT signaling pathway, MAPK signaling pathway, Melanoma, mTOR signaling pathway, Neurotrophin signaling pathway, Non-small cell lung cancer, Pancreatic cancer, Pathways in cancer, Progesterone-mediated oocyte maturation, Prostate cancer, Renal cell carcinoma, Small cell lung cancer, T cell receptor signaling pathway, Tight junction, Toll-like receptor signaling pathway, VEGF signaling pathway
Write Your Own Review
You're reviewing:AKT1 (NM_001014431) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301850 AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_001014431) 10 ug
$3,255.00
PH320257 AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_005154) 10 ug
$3,255.00
PH320361 AKT1 MS Standard C13 and N15-labeled recombinant protein (NP_001014432) 10 ug
$3,255.00
LC401580 AKT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423056 AKT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423057 AKT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425358 AKT1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401580 Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1 100 ug
$436.00
LY423056 Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 3 100 ug
$436.00
LY423057 Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2 100 ug
$665.00
LY425358 Transient overexpression lysate of v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2 100 ug
$436.00
TP320257 Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 1, 20 µg 20 ug
$737.00
TP320361 Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1), transcript variant 2, 20 µg 20 ug
$737.00
TP700055 Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1) mutant (E17K), transcript variant 1 20 ug
$867.00
TP700060 Recombinant protein of human v-akt murine thymoma viral oncogene homolog 1 (AKT1 mutant S473D), transcript variant 1, with C-terminal MYC/DDK tag, expressed in human cells, 20ug 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.