HADHSC (HADH) (NM_005327) Human Recombinant Protein

SKU
TP301752
Recombinant protein of human hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201752 protein sequence
Red=Cloning site Green=Tags(s)

MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI
EESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE
HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS
CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM
DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 32.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005318
Locus ID 3033
UniProt ID Q16836
Cytogenetics 4q25
RefSeq Size 1986
RefSeq ORF 942
Synonyms HAD; HADH1; HADHSC; HCDH; HHF4; MSCHAD; SCHAD
Summary This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. [provided by RefSeq, May 2010]
Protein Pathways Butanoate metabolism, Fatty acid elongation in mitochondria, Fatty acid metabolism, leucine and isoleucine degradation, Lysine degradation, Metabolic pathways, Tryptophan metabolism, Valine
Write Your Own Review
You're reviewing:HADHSC (HADH) (NM_005327) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301752 HADH MS Standard C13 and N15-labeled recombinant protein (NP_005318) 10 ug
$3,255.00
LC401643 HADH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432896 HADH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401643 Transient overexpression lysate of hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein 100 ug
$436.00
LY432896 Transient overexpression lysate of hydroxyacyl-CoA dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.