HADHSC (HADH) (NM_005327) Human Mass Spec Standard

SKU
PH301752
HADH MS Standard C13 and N15-labeled recombinant protein (NP_005318)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201752]
Predicted MW 34.3 kDa
Protein Sequence
Protein Sequence
>RC201752 protein sequence
Red=Cloning site Green=Tags(s)

MAFVTRQFMRSVSSSSTASASAKKIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGI
EESLRKVAKKKFAENPKAGDEFVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAE
HTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVS
CKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEM
DAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005318
RefSeq Size 1986
RefSeq ORF 942
Synonyms HAD; HADH1; HADHSC; HCDH; HHF4; MSCHAD; SCHAD
Locus ID 3033
UniProt ID Q16836
Cytogenetics 4q25
Summary This gene is a member of the 3-hydroxyacyl-CoA dehydrogenase gene family. The encoded protein functions in the mitochondrial matrix to catalyze the oxidation of straight-chain 3-hydroxyacyl-CoAs as part of the beta-oxidation pathway. Its enzymatic activity is highest with medium-chain-length fatty acids. Mutations in this gene cause one form of familial hyperinsulinemic hypoglycemia. The human genome contains a related pseudogene of this gene on chromosome 15. [provided by RefSeq, May 2010]
Protein Pathways Butanoate metabolism, Fatty acid elongation in mitochondria, Fatty acid metabolism, leucine and isoleucine degradation, Lysine degradation, Metabolic pathways, Tryptophan metabolism, Valine
Write Your Own Review
You're reviewing:HADHSC (HADH) (NM_005327) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401643 HADH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432896 HADH HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401643 Transient overexpression lysate of hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein 100 ug
$436.00
LY432896 Transient overexpression lysate of hydroxyacyl-CoA dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
TP301752 Recombinant protein of human hydroxyacyl-Coenzyme A dehydrogenase (HADH), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.