EIF3F (NM_003754) Human Recombinant Protein

SKU
TP301740
Recombinant protein of human eukaryotic translation initiation factor 3, subunit F (EIF3F), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201740 representing NM_003754
Red=Cloning site Green=Tags(s)

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL
NEKLVNL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Tag C-Myc/DDK
Predicted MW 37.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003745
Locus ID 8665
UniProt ID O00303
Cytogenetics 11p15.4
RefSeq Size 1274
RefSeq ORF 1071
Synonyms eIF3-p47; EIF3S5; MRT67
Summary Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:EIF3F (NM_003754) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301740 EIF3F MS Standard C13 and N15-labeled recombinant protein (NP_003745) 10 ug
$3,255.00
LC418450 EIF3F HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418450 Transient overexpression lysate of eukaryotic translation initiation factor 3, subunit F (EIF3F) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.