EIF3F (NM_003754) Human Tagged ORF Clone

SKU
RC201740
EIF3F (Myc-DDK-tagged)-Human eukaryotic translation initiation factor 3, subunit F (EIF3F)
  • TrueORF Gold

    Protein expression verified by Western blot, fully sequenced and in stock

    Click here to learn more.

$686.00
In Stock*
Specifications
Product Data
Type Human Tagged ORF Clone
Target Symbol EIF3F
Synonyms eIF3-p47; EIF3S5; MRT67
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>RC201740 representing NM_003754
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCCACACCGGCGGTACCAGTAAGTGCTCCTCCGGCCACGCCAACCCCAGTCCCGGCGGCGGCCCCAG
CCTCAGTTCCAGCGCCAACGCCAGCACCGGCTGCGGCTCCGGTTCCCGCTGCGGCTCCAGCCTCATCCTC
AGACCCTGCGGCAGCAGCGGCTGCAACTGCGGCTCCTGGCCAGACCCCGGCCTCAGCGCAAGCTCCAGCG
CAGACCCCAGCGCCCGCTCTGCCTGGTCCTGCTCTTCCAGGGCCCTTCCCCGGCGGCCGCGTGGTCAGGC
TGCACCCAGTCATTTTGGCCTCCATTGTGGACAGCTACGAGAGACGCAACGAGGGTGCTGCCCGAGTTAT
CGGGACCCTGTTGGGAACTGTCGACAAACACTCAGTGGAGGTCACCAATTGCTTTTCAGTGCCGCACAAT
GAGTCAGAAGATGAAGTGGCTGTTGACATGGAATTTGCTAAGAATATGTATGAACTGCATAAAAAAGTTT
CTCCAAATGAGCTCATCCTGGGCTGGTACGCTACGGGCCATGACATCACAGAGCACTCTGTGCTGATCCA
TGAGTACTACAGCCGAGAGGCCCCCAACCCCATCCACCTCACTGTGGACACAAGTCTCCAGAACGGCCGC
ATGAGCATCAAAGCCTACGTCAGCACTTTAATGGGAGTCCCTGGGAGGACCATGGGAGTGATGTTCACGC
CTCTGACAGTGAAATACGCGTACTACGACACTGAACGCATCGGAGTTGACCTGATCATGAAGACCTGCTT
TAGCCCCAACAGAGTGATTGGACTCTCAAGTGACTTGCAGCAAGTAGGAGGGGCATCAGCTCGCATCCAG
GATGCCCTGAGTACAGTGTTGCAATATGCAGAGGATGTACTGTCTGGAAAGGTGTCAGCTGACAATACTG
TGGGCCGCTTCCTGATGAGCCTGGTTAACCAAGTACCGAAAATAGTTCCCGATGACTTTGAGACCATGCT
CAACAGCAACATCAATGACCTTTTGATGGTGACCTACCTGGCCAACCTCACACAGTCACAGATTGCACTC
AATGAAAAACTTGTAAACCTG


AGCGGACCGACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCC
TGGATTACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC201740 representing NM_003754
Red=Cloning site Green=Tags(s)

MATPAVPVSAPPATPTPVPAAAPASVPAPTPAPAAAPVPAAAPASSSDPAAAAAATAAPGQTPASAQAPA
QTPAPALPGPALPGPFPGGRVVRLHPVILASIVDSYERRNEGAARVIGTLLGTVDKHSVEVTNCFSVPHN
ESEDEVAVDMEFAKNMYELHKKVSPNELILGWYATGHDITEHSVLIHEYYSREAPNPIHLTVDTSLQNGR
MSIKAYVSTLMGVPGRTMGVMFTPLTVKYAYYDTERIGVDLIMKTCFSPNRVIGLSSDLQQVGGASARIQ
DALSTVLQYAEDVLSGKVSADNTVGRFLMSLVNQVPKIVPDDFETMLNSNINDLLMVTYLANLTQSQIAL
NEKLVNL

SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-RsrII Cloning Scheme for this gene Plasmid Map
ACCN NM_003754
ORF Size 1071 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_003754.1, NP_003745.1
RefSeq Size 1274 bp
RefSeq ORF 1074 bp
Locus ID 8665
UniProt ID O00303
Cytogenetics 11p15.4
Domains JAB_MPN
Protein Families Druggable Genome
MW 37.4 kDa
Summary Component of the eukaryotic translation initiation factor 3 (eIF-3) complex, which is required for several steps in the initiation of protein synthesis (PubMed:17581632, PubMed:25849773, PubMed:27462815). The eIF-3 complex associates with the 40S ribosome and facilitates the recruitment of eIF-1, eIF-1A, eIF-2:GTP:methionyl-tRNAi and eIF-5 to form the 43S pre-initiation complex (43S PIC). The eIF-3 complex stimulates mRNA recruitment to the 43S PIC and scanning of the mRNA for AUG recognition. The eIF-3 complex is also required for disassembly and recycling of post-termination ribosomal complexes and subsequently prevents premature joining of the 40S and 60S ribosomal subunits prior to initiation (PubMed:17581632). The eIF-3 complex specifically targets and initiates translation of a subset of mRNAs involved in cell proliferation, including cell cycling, differentiation and apoptosis, and uses different modes of RNA stem-loop binding to exert either translational activation or repression (PubMed:25849773).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:EIF3F (NM_003754) Human Tagged ORF Clone
Your Rating
SKU Description Size Price
RC201740L1 Lenti ORF clone of Human eukaryotic translation initiation factor 3, subunit F (EIF3F), Myc-DDK-tagged 10 ug
$986.00
RC201740L2 Lenti ORF clone of Human eukaryotic translation initiation factor 3, subunit F (EIF3F), mGFP tagged 10 ug
$986.00
RC201740L3 Lenti ORF clone of Human eukaryotic translation initiation factor 3, subunit F (EIF3F), Myc-DDK-tagged 10 ug
$986.00
RC201740L4 Lenti ORF clone of Human eukaryotic translation initiation factor 3, subunit F (EIF3F), mGFP tagged 10 ug
$986.00
RG201740 EIF3F (tGFP-tagged) - Human eukaryotic translation initiation factor 3, subunit F (EIF3F) 10 ug
$886.00
SC324360 EIF3F (untagged)-Human eukaryotic translation initiation factor 3, subunit F (EIF3F) 10 ug
$686.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.