Adrenodoxin (FDX1) (NM_004109) Human Recombinant Protein

SKU TP301647

Purified recombinant protein of Homo sapiens ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein, 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201647 protein sequence; Red=Cloning site Green=Tags(s); ; MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH; FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL; AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13.5 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004100
• Locus ID: 2230
• UniProt ID: P10109
• Cytogenetics: 11q22.3
• RefSeq Size: 3155
• RefSeq ORF: 552
• Synonyms: ADX; FDX; LOH11CR1D
• Summary: This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]