Adrenodoxin (FDX1) (NM_004109) Human Mass Spec Standard

SKU
PH301647
FDX1 MS Standard C13 and N15-labeled recombinant protein (NP_004100)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201647]
Predicted MW 19.4 kDa
Protein Sequence
Protein Sequence
>RC201647 protein sequence
Red=Cloning site Green=Tags(s)

MAAAGGARLLRAASAVLGGPAGRWLHHAGSRAGSSGLLRNRGPGGSAEASRSLSVSARARSSSEDKITVH
FINRDGETLTTKGKVGDSLLDVVVENNLDIDGFGACEGTLACSTCHLIFEDHIYEKLDAITDEENDMLDL
AYGLTDRSRLGCQICLTKSMDNMTVRVPETVADARQSIDVGKTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004100
RefSeq Size 3155
RefSeq ORF 552
Synonyms ADX; FDX; LOH11CR1D
Locus ID 2230
UniProt ID P10109
Cytogenetics 11q22.3
Summary This gene encodes a small iron-sulfur protein that transfers electrons from NADPH through ferredoxin reductase to mitochondrial cytochrome P450, involved in steroid, vitamin D, and bile acid metabolism. Pseudogenes of this functional gene are found on chromosomes 20 and 21. [provided by RefSeq, Aug 2011]
Write Your Own Review
You're reviewing:Adrenodoxin (FDX1) (NM_004109) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401330 FDX1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401330 Transient overexpression lysate of ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein 100 ug
$436.00
TP301647 Purified recombinant protein of Homo sapiens ferredoxin 1 (FDX1), nuclear gene encoding mitochondrial protein, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.