OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

RING finger protein unkempt like (UNKL) (NM_023076) Human Recombinant Protein

  • Product Brand Image
Be the first to review this product
SKU
TP301609
Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg
Size:
20 ug 1 mg 100 ug
  $867.00
In Stock*
Bulk/Customize

Frequently Bought Together (1)

TA592569 DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
100 ul
$519.00

Other products for "RING finger protein unkempt like or NM_023076"

Specifications
Specifications
Product Data
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201609 representing NM_023076
Red=Cloning site Green=Tags(s)

MTCCSQVPPRRRPSLALSPRLDCNGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGAELARVR
RQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQVKQLQEELEGLG
VASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCE
PCAATAPECPYCKGQPLQW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_075564
Locus ID 64718
UniProt ID Q9H9P5
Cytogenetics 16p13.3
RefSeq Size 4135
RefSeq ORF 699
Synonyms C16orf28; ZC3H5L; ZC3HDC5L
Summary This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. provided by RefSeq, Jun 2013
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "RING finger protein unkempt like" proteins (6)
SKU Description Size Price
PH314684 UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202) 10 ug
$3,360.00
LC422146 Lyophilized UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC434369 Lyophilized UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422146 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY434369 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP314684 Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products