RING finger protein unkempt like (UNKL) (NM_023076) Human Recombinant Protein

SKU
TP301609
Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201609 representing NM_023076
Red=Cloning site Green=Tags(s)

MTCCSQVPPRRRPSLALSPRLDCNGLNGVPGSIWDFVSGSFSPSPSPILSAGPPSSSSASPNGAELARVR
RQLDEAKRKIRQWEESWQQVKQVCDAWQREAQEAKERARVADSDRQLALQKKEEVEAQVKQLQEELEGLG
VASTLPGLRGCGDIGTIPLPKLHSLQSQLRLDLEAVDGVIFQLRAKQCVACRERAHGAVLRPCQHHILCE
PCAATAPECPYCKGQPLQW

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 25 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_075564
Locus ID 64718
UniProt ID Q9H9P5
Cytogenetics 16p13.3
RefSeq Size 4135
RefSeq ORF 699
Synonyms C16orf28; ZC3H5L; ZC3HDC5L
Summary This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RING finger protein unkempt like (UNKL) (NM_023076) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH314684 UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202) 10 ug
$3,255.00
LC422146 UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434369 UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422146 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 100 ug
$436.00
LY434369 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 100 ug
$665.00
TP314684 Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.