RING finger protein unkempt like (UNKL) (NM_001037125) Human Mass Spec Standard

SKU
PH314684
UNKL MS Standard C13 and N15-labeled recombinant protein (NP_001032202)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC214684]
Predicted MW 31.6 kDa
Protein Sequence
Protein Sequence
>RC214684 representing NM_001037125
Red=Cloning site Green=Tags(s)

MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD
GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF
AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT
EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001032202
RefSeq Size 1401
RefSeq ORF 831
Synonyms C16orf28; ZC3H5L; ZC3HDC5L
Locus ID 64718
UniProt ID Q9H9P5
Cytogenetics 16p13.3
Summary This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RING finger protein unkempt like (UNKL) (NM_001037125) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC422146 UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC434369 UNKL HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY422146 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 100 ug
$436.00
LY434369 Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 100 ug
$665.00
TP301609 Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg 20 ug
$867.00
TP314684 Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.