RING finger protein unkempt like (UNKL) (NM_001037125) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC214684] |
Predicted MW | 31.6 kDa |
Protein Sequence |
Protein Sequence
>RC214684 representing NM_001037125
Red=Cloning site Green=Tags(s) MPSVSKAAAAALSGSPPQTEKPTHYRYLKEFRTEQCPLFSQHKCAQHRPFTCFHWHFLNQRRRRPLRRRD GTFNYSPDVYCSKYNEATGVCPDGDECPYLHRTTGDTERKYHLRYYKTGTCIHETDARGHCVKNGLHCAF AHGPLDLRPPVCDVRELQAQEALQNGQLGGGEGVPDLQPGVLASQAMIEKILSEDPRWQDANFVLGSYKT EQCPKPPRLCRQGYACPHYHNSRDRRRNPRRFQYSWQLGRRVLRLSPRANNPRVALPRVHTGPSSTA myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001032202 |
RefSeq Size | 1401 |
RefSeq ORF | 831 |
Synonyms | C16orf28; ZC3H5L; ZC3HDC5L |
Locus ID | 64718 |
UniProt ID | Q9H9P5 |
Cytogenetics | 16p13.3 |
Summary | This gene encodes a RING finger protein that may function in Rac signaling. It can bind to Brg/Brm-associated factor 60b and can promote its ubiquitination. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC422146 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC434369 | UNKL HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY422146 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 2 | 100 ug |
$436.00
|
|
LY434369 | Transient overexpression lysate of unkempt homolog (Drosophila)-like (UNKL), transcript variant 1 | 100 ug |
$665.00
|
|
TP301609 | Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
TP314684 | Recombinant protein of human unkempt homolog (Drosophila)-like (UNKL), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.