Lamin B1 (LMNB1) (NM_005573) Human Recombinant Protein

SKU
TP301604
Recombinant protein of human lamin B1 (LMNB1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201604 protein sequence
Red=Cloning site Green=Tags(s)

MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV
RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA
ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE
MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR
DQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL
KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA
AGVVVEEELFHQQGTPRASNRSCAIM

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 66.2 kDa
Concentration >0.1 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Bioactivity Proteolysis substrate (PMID: 27079252)
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_005564
Locus ID 4001
UniProt ID P20700
Cytogenetics 5q23.2
RefSeq Size 3420
RefSeq ORF 1758
Synonyms ADLD; LMN; LMN2; LMNB; MCPH26
Summary This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:Lamin B1 (LMNB1) (NM_005573) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301604 LMNB1 MS Standard C13 and N15-labeled recombinant protein (NP_005564) 10 ug
$3,255.00
LC417217 LMNB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417217 Transient overexpression lysate of lamin B1 (LMNB1) 100 ug
$436.00
TP762496 Purified recombinant protein of Human lamin B1 (LMNB1), transcript variant 1, 418Arg-582Ser, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.