Lamin B1 (LMNB1) (NM_005573) Human Mass Spec Standard

SKU
PH301604
LMNB1 MS Standard C13 and N15-labeled recombinant protein (NP_005564)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201604]
Predicted MW 66.4 kDa
Protein Sequence
Protein Sequence
>RC201604 protein sequence
Red=Cloning site Green=Tags(s)

MATATPVPPRMGSRAGGPTTPLSPTRLSRLQEKEELRELNDRLAVYIDKVRSLETENSALQLQVTEREEV
RGRELTGLKALYETELADARRALDDTARERAKLQIELGKCKAEHDQLLLNYAKKESDLNGAQIKLREYEA
ALNSKDAALATALGDKKSLEGDLEDLKDQIAQLEASLAAAKKQLADETLLKVDLENRCQSLTEDLEFRKS
MYEEEINETRRKHETRLVEVDSGRQIEYEYKLAQALHEMREQHDAQVRLYKEELEQTYHAKLENARLSSE
MNTSTVNSAREELMESRMRIESLSSQLSNLQKESRACLERIQELEDLLAKEKDNSRRMLTDKEREMAEIR
DQMQQQLNDYEQLLDVKLALDMEISAYRKLLQGEEERLKLSPSPSSRVTVSRASSSRSVRTTRGKRKRVD
VEESEASSSVSISHSASATGNVCIEEIDVDGKFIRLKNTSEQDQPMGGWEMIRKIGDTSVSYKYTSRYVL
KAGQTVTIWAANAGVTASPPTDLIWKNQNSWGTGEDVKVILKNSQGEEVAQRSTVFKTTIPEEEEEEEEA
AGVVVEEELFHQQGTPRASNRSCAIM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005564
RefSeq Size 3420
RefSeq ORF 1758
Synonyms ADLD; LMN; LMN2; LMNB; MCPH26
Locus ID 4001
UniProt ID P20700
Cytogenetics 5q23.2
Summary This gene encodes one of the two B-type lamin proteins and is a component of the nuclear lamina. A duplication of this gene is associated with autosomal dominant adult-onset leukodystrophy (ADLD). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
Write Your Own Review
You're reviewing:Lamin B1 (LMNB1) (NM_005573) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417217 LMNB1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417217 Transient overexpression lysate of lamin B1 (LMNB1) 100 ug
$436.00
TP301604 Recombinant protein of human lamin B1 (LMNB1), 20 µg 20 ug
$867.00
TP762496 Purified recombinant protein of Human lamin B1 (LMNB1), transcript variant 1, 418Arg-582Ser, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.