CFDP1 (NM_006324) Human Recombinant Protein

SKU
TP301581
Recombinant protein of human craniofacial development protein 1 (CFDP1), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201581 protein sequence
Red=Cloning site Green=Tags(s)

MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSL
EEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE
ETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALP
SLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR
VDHRQFEIERDLRLSKMKP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 33.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_006315
Locus ID 10428
UniProt ID Q9UEE9
Cytogenetics 16q23.1
RefSeq Size 1281
RefSeq ORF 897
Synonyms BCNT; BUCENTAUR; CENP-29; CP27; p97; SWC5; Yeti
Summary May play a role during embryogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CFDP1 (NM_006324) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301581 CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315) 10 ug
$3,255.00
LC416717 CFDP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416717 Transient overexpression lysate of craniofacial development protein 1 (CFDP1) 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.