CFDP1 (NM_006324) Human Mass Spec Standard

SKU
PH301581
CFDP1 MS Standard C13 and N15-labeled recombinant protein (NP_006315)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201581]
Predicted MW 33.6 kDa
Protein Sequence
Protein Sequence
>RC201581 protein sequence
Red=Cloning site Green=Tags(s)

MEEFDSEDFSTSEEDEDYVPSGGEYSEDDVNELVKEDEVDGEEQTQKTQGKKRKAQSIPARKRRQGGLSL
EEEEEEDANSESEGSSSEEEDDAAEQEKGIGSEDARKKKEDELWASFLNDVGPKSKVPPSTQVKKGEETE
ETSSSKLLVKAEELEKPKETEKVKITKVFDFAGEEVRVTKEVDATSKEAKSFFKQNEKEKPQANVPSALP
SLPAGSGLKRSSGMSSLLGKIGAKKQKMSTLEKSKLDWESFKEEEGIGEELAIHNRGKEGYIERKAFLDR
VDHRQFEIERDLRLSKMKP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006315
RefSeq Size 1281
RefSeq ORF 897
Synonyms BCNT; BUCENTAUR; CENP-29; CP27; p97; SWC5; Yeti
Locus ID 10428
UniProt ID Q9UEE9
Cytogenetics 16q23.1
Summary May play a role during embryogenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CFDP1 (NM_006324) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416717 CFDP1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416717 Transient overexpression lysate of craniofacial development protein 1 (CFDP1) 100 ug
$436.00
TP301581 Recombinant protein of human craniofacial development protein 1 (CFDP1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.