L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Recombinant Protein

SKU
TP301559
Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201559 protein sequence
Red=Cloning site Green=Tags(s)

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA
GAGGIAGAFIHEKHAHTIKPARSEFFN

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 34.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_001028170
Locus ID 8942
UniProt ID Q16719
Cytogenetics 2q22.2
RefSeq Size 1315
RefSeq ORF 921
Synonyms KYNUU; VCRL2
Summary Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Protein Families Protease
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301559 KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170) 10 ug
$3,255.00
LC418347 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422334 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429170 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418347 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1 100 ug
$665.00
LY422334 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 100 ug
$436.00
TP762412 Purified recombinant protein of Human kynureninase (KYNU), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.