L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard

SKU
PH301559
KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201559]
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC201559 protein sequence
Red=Cloning site Green=Tags(s)

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA
GAGGIAGAFIHEKHAHTIKPARSEFFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028170
RefSeq Size 1315
RefSeq ORF 921
Synonyms KYNUU; VCRL2
Locus ID 8942
UniProt ID Q16719
Cytogenetics 2q22.2
Summary Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
Protein Families Protease
Protein Pathways Metabolic pathways, Tryptophan metabolism
Write Your Own Review
You're reviewing:L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418347 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422334 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC429170 KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418347 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1 100 ug
$665.00
LY422334 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 100 ug
$436.00
TP301559 Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2, 20 µg 20 ug
$867.00
TP762412 Purified recombinant protein of Human kynureninase (KYNU), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$226.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.