OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard

Be the first to review this product
SKU
PH301559
KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170)
Size:
10 ug
  $3,360.00
In Stock*
Bulk/Customize

Frequently Bought Together (2)

TA803959 KYNU mouse monoclonal antibody, clone OTI1H1 (formerly 1H1) 100 ul
$447.00
LY422334 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "L Kynurenine Hydrolase or NM_001032998"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201559
Predicted MW 34.6 kDa
Protein Sequence
Protein Sequence
>RC201559 protein sequence
Red=Cloning site Green=Tags(s)

MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY
FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN
LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK
EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA
GAGGIAGAFIHEKHAHTIKPARSEFFN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001028170
RefSeq Size 1315
RefSeq ORF 921
Synonyms KYNUU; VCRL2
Locus ID 8942
UniProt ID Q16719
Cytogenetics 2q22.2
Summary Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. provided by RefSeq, Nov 2010
Protein Families Protease
Protein Pathways Metabolic pathways, Tryptophan metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "L Kynurenine Hydrolase" proteins (6)
SKU Description Size Price
LC418347 Lyophilized KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422334 Lyophilized KYNU HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY418347 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1 (as WB positive control) 100 ug
$665.00
LY422334 Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP301559 Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2, 20 µg 20 ug
$867.00
TP762412 Purified recombinant protein of Human kynureninase (KYNU), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug 50 ug
$240.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products