L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC201559] |
Predicted MW | 34.6 kDa |
Protein Sequence |
Protein Sequence
>RC201559 protein sequence
Red=Cloning site Green=Tags(s) MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA GAGGIAGAFIHEKHAHTIKPARSEFFN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_001028170 |
RefSeq Size | 1315 |
RefSeq ORF | 921 |
Synonyms | KYNUU; VCRL2 |
Locus ID | 8942 |
UniProt ID | Q16719 |
Cytogenetics | 2q22.2 |
Summary | Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010] |
Protein Families | Protease |
Protein Pathways | Metabolic pathways, Tryptophan metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC418347 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC422334 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429170 | KYNU HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY418347 | Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 1 | 100 ug |
$665.00
|
|
LY422334 | Transient overexpression lysate of kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2 | 100 ug |
$436.00
|
|
TP301559 | Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP762412 | Purified recombinant protein of Human kynureninase (KYNU), transcript variant 1, full length, with N-terminal His tag, expressed in E.coli, 50ug | 50 ug |
$226.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.