OCIAD1 (NM_017830) Human Recombinant Protein

SKU
TP301506
Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201506 protein sequence
Red=Cloning site Green=Tags(s)

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 27.4 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060300
Locus ID 54940
UniProt ID Q9NX40
Cytogenetics 4p11
RefSeq Size 2005
RefSeq ORF 735
Synonyms ASRIJ; OCIA; TPA018
Summary Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:OCIAD1 (NM_017830) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301506 OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300) 10 ug
$3,255.00
PH320792 OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) 10 ug
$3,255.00
LC402620 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421553 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421556 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402620 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 100 ug
$436.00
LY421553 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 100 ug
$436.00
LY421556 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 100 ug
$436.00
TP320792 Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.