OCIAD1 (NM_017830) Human Mass Spec Standard

SKU
PH301506
OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201506]
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC201506 protein sequence
Red=Cloning site Green=Tags(s)

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060300
RefSeq Size 2005
RefSeq ORF 735
Synonyms ASRIJ; OCIA; TPA018
Locus ID 54940
UniProt ID Q9NX40
Cytogenetics 4p11
Summary Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:OCIAD1 (NM_017830) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH320792 OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) 10 ug
$3,255.00
LC402620 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421553 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421556 OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402620 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 100 ug
$436.00
LY421553 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 100 ug
$436.00
LY421556 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 100 ug
$436.00
TP301506 Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg 20 ug
$737.00
TP320792 Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.