OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OCIAD1 (NM_017830) Human Mass Spec Standard

Be the first to review this product
SKU
PH301506
OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_060300)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA379439 OCIAD1 Rabbit polyclonal Antibody
100 ul
$410.00
LY402620 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "OCIAD1 or NM_017830"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201506
Predicted MW 27.6 kDa
Protein Sequence
Protein Sequence
>RC201506 protein sequence
Red=Cloning site Green=Tags(s)

MNGRADFREPNAEVPRPIPHIGPDYIPTEEERRVFAECNDESFWFRSVPLAATSMLITQGLISKGILSSH
PKYGSIPKLILACIMGYFAGKLSYVKTCQEKFKKLENSPLGEALRSGQARRSSPPGHYYQKSKYDSSVSG
QSSFVTSPAADNIEMLPHYEPIPFSSSMNESAPTGITDHIVQGPDPNLEESPKRKNITYEELRNKNRESY
EVSLTQKTDPSVRPMHERVPKKEVKVNKYGDTWDE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060300
RefSeq Size 2005
RefSeq ORF 735
Synonyms ASRIJ; OCIA; TPA018
Locus ID 54940
UniProt ID Q9NX40
Cytogenetics 4p11
Summary Maintains stem cell potency (By similarity). Increases STAT3 phosphorylation and controls ERK phosphorylation (By similarity). May act as a scaffold, increasing STAT3 recruitment onto endosomes (By similarity). Involved in integrin-mediated cancer cell adhesion and colony formation in ovarian cancer (PubMed:20515946).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OCIAD1" proteins (9)
SKU Description Size Price
PH320792 OCIAD1 MS Standard C13 and N15-labeled recombinant protein (NP_001073311) 10 ug
$3,360.00
LC402620 Lyophilized OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421553 Lyophilized OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421556 Lyophilized OCIAD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402620 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY421553 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY421556 Transient overexpression lysate of OCIA domain containing 1 (OCIAD1), transcript variant 5 (as WB positive control) 100 ug
$436.00
TP301506 Recombinant protein of human OCIA domain containing 1 (OCIAD1), transcript variant 1, 20 µg 20 ug
$737.00
TP320792 Purified recombinant protein of Homo sapiens OCIA domain containing 1 (OCIAD1), transcript variant 5, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products