MOBK1B (MOB1A) (NM_018221) Human Recombinant Protein

SKU
TP301487
Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201487 representing NM_018221
Red=Cloning site Green=Tags(s)

MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM
LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
LGSKDR

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 24.9 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_060691
Locus ID 55233
UniProt ID Q9H8S9
Cytogenetics 2p13.1
RefSeq Size 2543
RefSeq ORF 648
Synonyms C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B
Summary The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:MOBK1B (MOB1A) (NM_018221) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301487 MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691) 10 ug
$3,255.00
LC413201 MOB1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413201 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) 100 ug
$436.00
TP720267 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.