MOBK1B (MOB1A) (NM_018221) Human Mass Spec Standard

SKU PH301487

MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201487]
• Predicted MW: 24.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC201487 representing NM_018221; Red=Cloning site Green=Tags(s); ; MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM; LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF; PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK; LGSKDR; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_060691
• RefSeq Size: 2543
• RefSeq ORF: 648
• Synonyms: C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B
• Locus ID: 55233
• UniProt ID: Q9H8S9
• Cytogenetics: 2p13.1
• Summary: The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
• Protein Families: Druggable Genome