OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

MOBK1B (MOB1A) (NM_018221) Human Mass Spec Standard

Be the first to review this product
SKU
PH301487
MOBKL1B MS Standard C13 and N15-labeled recombinant protein (NP_060691)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA351408 Rabbit Polyclonal Anti-MOB1A Antibody
100 ul
$205.00
LY413201 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) (as WB positive control) 100 ug
$436.00

Other products for "MOBK1B or NM_018221"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201487
Predicted MW 24.9 kDa
Protein Sequence
Protein Sequence
>RC201487 representing NM_018221
Red=Cloning site Green=Tags(s)

MSFLFSSRSSKTFKPKKNIPEGSHQYELLKHAEATLGSGNLRQAVMLPEGEDLNEWIAVNTVDFFNQINM
LYGTITEFCTEASCPVMSAGPRYEYHWADGTNIKKPIKCSAPKYIDYLMTWVQDQLDDETLFPSKIGVPF
PKNFMSVAKTILKRLFRVYAHIYHQHFDSVMQLQEEAHLNTSFKHFIFFVQEFNLIDRRELAPLQELIEK
LGSKDR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060691
RefSeq Size 2543
RefSeq ORF 648
Synonyms C2orf6; MATS1; MOB1; Mob4B; MOBK1B; MOBKL1B
Locus ID 55233
UniProt ID Q9H8S9
Cytogenetics 2p13.1
Summary The protein encoded by this gene is a component of the Hippo signaling pathway, which controls organ size and tumor growth by enhancing apoptosis. Loss of the encoded protein results in cell proliferation and cancer formation. The encoded protein is also involved in the control of microtubule stability during cytokinesis. Several transcript variants encoding different isoforms have been found for this gene. provided by RefSeq, Nov 2015
Protein Families Druggable Genome
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "MOBK1B" proteins (4)
SKU Description Size Price
LC413201 Lyophilized MOB1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY413201 Transient overexpression lysate of MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) (as WB positive control) 100 ug
$436.00
TP301487 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B), 20 µg 20 ug
$867.00
TP720267 Recombinant protein of human MOB1, Mps One Binder kinase activator-like 1B (yeast) (MOBKL1B) 10 ug
$340.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products