Breast cancer suppressor candidate 1 (VWA5A) (NM_198315) Human Recombinant Protein
SKU
TP301474
Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg
$564.00
MSRP
$867.00
MSRP
$867.00
4 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Species | Human |
---|---|
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
Protein Sequence
>RC201474 protein sequence
Red=Cloning site Green=Tags(s) MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 45.7 kDa |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_938057 |
Locus ID | 4013 |
UniProt ID | O00534 |
Cytogenetics | 11q24.2 |
RefSeq Size | 1874 |
RefSeq ORF | 1245 |
Synonyms | BCSC-1; BCSC1; LOH11CR2A |
Summary | May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function] |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH301474 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) | 10 ug |
$3,255.00
|
|
PH312185 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437) | 10 ug |
$3,255.00
|
|
PH326168 | VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) | 10 ug |
$3,255.00
|
|
LC402354 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC405013 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC427178 | VWA5A HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY402354 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 | 100 ug |
$665.00
|
|
LY405013 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 | 100 ug |
$436.00
|
|
LY427178 | Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 | 100 ug |
$665.00
|
|
TP312185 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP326168 | Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP710317 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug | 20 ug |
$515.00
|
|
TP761749 | Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug | 50 ug |
$261.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.