Breast cancer suppressor candidate 1 (VWA5A) (NM_014622) Human Mass Spec Standard

SKU
PH312185
VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_055437)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC212185]
Predicted MW 86.3 kDa
Protein Sequence
Protein Sequence
>RC212185 representing NM_014622
Red=Cloning site Green=Tags(s)

MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG
KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA
LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED
KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG
EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM
EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHRCFSFG
IGEGTSTSLIKGIARASGGTSEFITGKDRMQSKALRTLKRSLQPVVEDVSLSWHLPPGLSAKMLSPEQTV
IFRGQRLISYAQLTGRMPAAETTGEVCLKYTLQGKTFEDKVTFPLQPKPDVNLTIHRLAAKSLLQTKDMG
LRETPASDKKDALNLSLESGVISSFTAFIAINKELNKPVQGPLAHRDVPRPILLGASAPLKIKCQSGFRK
ALHSDRPPSASQPRGELMCYKAKTFQMDDYSLCGLISHKDQHSPGFGENHLVQLIYHQNANGSWDLNEDL
AKILGMSLEEIMAAQPAELVDSSGWATILAVIWLHSNGKDLKCEWELLERKAVAWMRAHAGSTMPSVVKA
AITFLKSSVDPAIFAF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055437
RefSeq Size 3438
RefSeq ORF 2358
Synonyms BCSC-1; BCSC1; LOH11CR2A
Locus ID 4013
UniProt ID O00534
Cytogenetics 11q24.2
Summary May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:Breast cancer suppressor candidate 1 (VWA5A) (NM_014622) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301474 VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057) 10 ug
$3,255.00
PH326168 VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_001123614) 10 ug
$3,255.00
LC402354 VWA5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC405013 VWA5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427178 VWA5A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402354 Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1 100 ug
$665.00
LY405013 Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2 100 ug
$436.00
LY427178 Transient overexpression lysate of von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3 100 ug
$665.00
TP301474 Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP312185 Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP326168 Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 3, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP710317 Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00
TP761749 Purified recombinant protein of Human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2, full length, with N-terminal His tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.