CCM2 (NM_031443) Human Recombinant Protein

SKU
TP301418
Recombinant protein of human cerebral cavernous malformation 2 (CCM2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$564.00 MSRP $867.00 MSRP $867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201418 protein sequence
Red=Cloning site Green=Tags(s)

MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYL
GQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA
AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELC
CLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS
PHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL
LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.7 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_113631
Locus ID 83605
UniProt ID Q9BSQ5
Cytogenetics 7p13
RefSeq Size 1904
RefSeq ORF 1332
Synonyms C7orf22; OSM; PP10187
Summary This gene encodes a scaffold protein that functions in the stress-activated p38 Mitogen-activated protein kinase (MAPK) signaling cascade. The protein interacts with SMAD specific E3 ubiquitin protein ligase 1 (also known as SMURF1) via a phosphotyrosine binding domain to promote RhoA degradation. The protein is required for normal cytoskeletal structure, cell-cell interactions, and lumen formation in endothelial cells. Mutations in this gene result in cerebral cavernous malformations. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]
Write Your Own Review
You're reviewing:CCM2 (NM_031443) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301418 CCM2 MS Standard C13 and N15-labeled recombinant protein (NP_113631) 10 ug
$3,255.00
LC410516 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422467 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425504 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432927 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432976 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410516 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 2 100 ug
$436.00
LY422467 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 100 ug
$665.00
LY425504 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 100 ug
$436.00
LY432927 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 4 100 ug
$436.00
LY432976 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.