CCM2 (NM_031443) Human Mass Spec Standard

SKU
PH301418
CCM2 MS Standard C13 and N15-labeled recombinant protein (NP_113631)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201418]
Predicted MW 48.8 kDa
Protein Sequence
Protein Sequence
>RC201418 protein sequence
Red=Cloning site Green=Tags(s)

MEEEGKKGKKPGIVSPFKRVFLKGEKSRDKKAHEKVTERRPLHTVVLSLPERVEPDRLLSDYIEKEVKYL
GQLTSIPGYLNPSSRTEILHFIDNAKRAHQLPGHLTQEHDAVLSLSAYNVKLAWRDGEDIILRVPIHDIA
AVSYVRDDAAHLVVLKTAQDPGISPSQSLCAESSRGLSAGSLSESAVGPVEACCLVILAAESKVAAEELC
CLLGQVFQVVYTESTIDFLDRAIFDGASTPTHHLSLHSDDSSTKVDIKETYEVEASTFCFPESVDVGGAS
PHSKTISESELSASATELLQDYMLTLRTKLSSQEIQQFAALLHEYRNGASIHEFCINLRQLYGDSRKFLL
LGLRPFIPEKDSQHFENFLETIGVKDGRGIITDSFGRHRRALSTTSSSTTNGNRATGSSDDRSAPSEGDE
WDRMISDISSDIEALGCSMDQDSA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_113631
RefSeq Size 1904
RefSeq ORF 1332
Synonyms C7orf22; OSM; PP10187
Locus ID 83605
UniProt ID Q9BSQ5
Cytogenetics 7p13
Summary This gene encodes a scaffold protein that functions in the stress-activated p38 Mitogen-activated protein kinase (MAPK) signaling cascade. The protein interacts with SMAD specific E3 ubiquitin protein ligase 1 (also known as SMURF1) via a phosphotyrosine binding domain to promote RhoA degradation. The protein is required for normal cytoskeletal structure, cell-cell interactions, and lumen formation in endothelial cells. Mutations in this gene result in cerebral cavernous malformations. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Nov 2009]
Write Your Own Review
You're reviewing:CCM2 (NM_031443) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410516 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422467 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC425504 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432927 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432976 CCM2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410516 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 2 100 ug
$436.00
LY422467 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 100 ug
$665.00
LY425504 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 1 100 ug
$436.00
LY432927 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 4 100 ug
$436.00
LY432976 Transient overexpression lysate of cerebral cavernous malformation 2 (CCM2), transcript variant 3 100 ug
$436.00
TP301418 Recombinant protein of human cerebral cavernous malformation 2 (CCM2), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.