OSBPL2 (NM_144498) Human Recombinant Protein

SKU
TP301344
Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 2, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
4 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201344 protein sequence
Red=Cloning site Green=Tags(s)

MNGEEEFFDAVTGFDSDNSSGEFSEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFS
RSDFSVWTILKKCVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSA
VASQWERTGKPFNPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKS
VEAEPRGTITLELLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKEL
HKVEGHIQDKNKKKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVA
QETVQVIPGSKLLWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLAS
QEKERLEEKQREARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 55 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_653081
Locus ID 9885
UniProt ID Q9H1P3
Cytogenetics 20q13.33
RefSeq Size 4027
RefSeq ORF 1440
Synonyms DFNA67; DNFA67; ORP-2; ORP2
Summary This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:OSBPL2 (NM_144498) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301344 OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_653081) 10 ug
$3,255.00
PH315660 OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650) 10 ug
$3,255.00
LC408266 OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414990 OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408266 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 100 ug
$436.00
LY414990 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 1 100 ug
$665.00
TP315660 Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.