OSBPL2 (NM_014835) Human Mass Spec Standard

SKU
PH315660
OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC215660]
Predicted MW 53.8 kDa
Protein Sequence
Protein Sequence
>RC215660 representing NM_014835
Red=Cloning site Green=Tags(s)

MNGEEEFFDAVTEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFSRSDFSVWTILKK
CVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPF
NPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLE
LLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNK
KKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
LWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQRE
ARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055650
RefSeq Size 3935
RefSeq ORF 1404
Synonyms DFNA67; DNFA67; ORP-2; ORP2
Locus ID 9885
UniProt ID Q9H1P3
Cytogenetics 20q13.33
Summary This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. [provided by RefSeq, Sep 2014]
Write Your Own Review
You're reviewing:OSBPL2 (NM_014835) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH301344 OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_653081) 10 ug
$3,255.00
LC408266 OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC414990 OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408266 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 100 ug
$436.00
LY414990 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 1 100 ug
$665.00
TP301344 Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 2, 20 µg 20 ug
$737.00
TP315660 Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.