OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

OSBPL2 (NM_014835) Human Mass Spec Standard

Be the first to review this product
SKU
PH315660
OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_055650)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA800553 OSBPL2 mouse monoclonal antibody, clone OTI2E6 (formerly 2E6) 100 ul
$447.00
LY408266 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 (as WB positive control) 100 ug
$436.00

Other products for "OSBPL2 or NM_014835"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC215660
Predicted MW 53.8 kDa
Protein Sequence
Protein Sequence
>RC215660 representing NM_014835
Red=Cloning site Green=Tags(s)

MNGEEEFFDAVTEANQKVTGMIDLDTSKNNRIGKTGERPSQENGIQKHRTSLPAPMFSRSDFSVWTILKK
CVGLELSKITMPIAFNEPLSFLQRITEYMEHVYLIHRASCQPQPLERMQSVAAFAVSAVASQWERTGKPF
NPLLGETYELIREDLGFRFISEQVSHHPPISAFHSEGLNHDFLFHGSIYPKLKFWGKSVEAEPRGTITLE
LLKHNEAYTWTNPTCCVHNVIIGKLWIEQYGTVEILNHRTGHKCVLHFKPCGLFGKELHKVEGHIQDKNK
KKLFMIYGKWTECLWGIDPVSYESFKKQERRGDHLRKAKLDEDSGKADSDVADDVPVAQETVQVIPGSKL
LWRINTRPPNSAQMYNFTSFTVSLNELETGMEKTLPPTDCRLRPDIRGMENGNMDLASQEKERLEEKQRE
ARRERAKEEAEWQTRWFYPGNNPYTGTPDWLYAGDYFERNFSDCPDIY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055650
RefSeq Size 3935
RefSeq ORF 1404
Synonyms DFNA67; DNFA67; ORP-2; ORP2
Locus ID 9885
UniProt ID Q9H1P3
Cytogenetics 20q13.33
Summary This gene encodes a member of the oxysterol-binding protein (OSBP) family, a group of intracellular lipid receptors. Most members contain an N-terminal pleckstrin homology domain and a highly conserved C-terminal OSBP-like sterol-binding domain, although the encoded protein contains only the sterol-binding domain. In vitro studies have shown that the encoded protein can bind strongly to phosphatic acid and weakly to phosphatidylinositol 3-phosphate, but cannot bind to 25-hydroxycholesterol. The protein associates with the Golgi apparatus. Transcript variants encoding different isoforms have been described. provided by RefSeq, Sep 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "OSBPL2" proteins (7)
SKU Description Size Price
PH301344 OSBPL2 MS Standard C13 and N15-labeled recombinant protein (NP_653081) 10 ug
$3,360.00
LC408266 Lyophilized OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC414990 Lyophilized OSBPL2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408266 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY414990 Transient overexpression lysate of oxysterol binding protein-like 2 (OSBPL2), transcript variant 1 (as WB positive control) 100 ug
$665.00
TP301344 Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 2, 20 µg 20 ug
$737.00
TP315660 Recombinant protein of human oxysterol binding protein-like 2 (OSBPL2), transcript variant 1, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products