TNIP2 (NM_024309) Human Recombinant Protein

SKU
TP301339
Recombinant protein of human TNFAIP3 interacting protein 2 (TNIP2), 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
5 Days*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201339 protein sequence
Red=Cloning site Green=Tags(s)

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAVQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 48.5 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_077285
Locus ID 79155
UniProt ID Q8NFZ5
Cytogenetics 4p16.3
RefSeq Size 1993
RefSeq ORF 1287
Synonyms ABIN2; FLIP1; KLIP
Summary This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.[provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:TNIP2 (NM_024309) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301339 TNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_077285) 10 ug
$3,255.00
LC411328 TNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411328 Transient overexpression lysate of TNFAIP3 interacting protein 2 (TNIP2), transcript variant 1 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.