TNIP2 (NM_024309) Human Mass Spec Standard

SKU
PH301339
TNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_077285)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201339]
Predicted MW 48.7 kDa
Protein Sequence
Protein Sequence
>RC201339 protein sequence
Red=Cloning site Green=Tags(s)

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAVQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077285
RefSeq Size 1993
RefSeq ORF 1287
Synonyms ABIN2; FLIP1; KLIP
Locus ID 79155
UniProt ID Q8NFZ5
Cytogenetics 4p16.3
Summary This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.[provided by RefSeq, May 2014]
Write Your Own Review
You're reviewing:TNIP2 (NM_024309) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411328 TNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411328 Transient overexpression lysate of TNFAIP3 interacting protein 2 (TNIP2), transcript variant 1 100 ug
$436.00
TP301339 Recombinant protein of human TNFAIP3 interacting protein 2 (TNIP2), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.