OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

TNIP2 (NM_024309) Human Mass Spec Standard

Be the first to review this product
SKU
PH301339
TNIP2 MS Standard C13 and N15-labeled recombinant protein (NP_077285)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY411328 Transient overexpression lysate of TNFAIP3 interacting protein 2 (TNIP2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "TNIP2 or NM_024309"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201339
Predicted MW 48.7 kDa
Protein Sequence
Protein Sequence
>RC201339 protein sequence
Red=Cloning site Green=Tags(s)

MSRDPGSGGWEEAPRAAAALCTLYHEAGQRLRRLQDQLAARDALIARLRARLAALEGDAAPSLVDALLEQ
VARFREQLRRQEGGAAEAQMRQEIERLTERLEEKEREMQQLLSQPQHEREKEVVLLRRSMAEGERARAAS
DVLCRSLANETHQLRRTLTATAHMCQHLAKCLDERQHAQRNVGERSPDQSEHTDGHTSVQSVIEKLQEEN
RLLKQKVTHVEDLNAKWQRYNASRDEYVRGLHAQLRGLQIPHEPELMRKEISRLNRQLEEKINDCAEVKQ
ELAASRTARDAALERVQMLEQQILAYKDDFMSERADRERAQSRIQELEEKVASLLHQVSWRQDSREPDAG
RIHAGSKTAKYLAADALELMVPGGWRPGTGSQQPEPPAEGGHPGAVQRGQGDLQCPHCLQCFSDEQGEEL
LRHVAECCQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077285
RefSeq Size 1993
RefSeq ORF 1287
Synonyms ABIN2; FLIP1; KLIP
Locus ID 79155
UniProt ID Q8NFZ5
Cytogenetics 4p16.3
Summary This gene encodes a protein which acts as an inhibitor of NFkappaB activation. The encoded protein is also involved in MAP/ERK signaling pathway in specific cell types. It may be involved in apoptosis of endothelial cells. Alternative splicing results in multiple transcript variants. A pseudogene related to this gene is located on the X chromosome.provided by RefSeq, May 2014
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "TNIP2" proteins (3)
SKU Description Size Price
LC411328 Lyophilized TNIP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY411328 Transient overexpression lysate of TNFAIP3 interacting protein 2 (TNIP2), transcript variant 1 (as WB positive control) 100 ug
$436.00
TP301339 Recombinant protein of human TNFAIP3 interacting protein 2 (TNIP2), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products