TRIM32 (NM_012210) Human Recombinant Protein

SKU
TP301289
Recombinant protein of human tripartite motif-containing 32 (TRIM32), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$737.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201289 protein sequence
Red=Cloning site Green=Tags(s)

MAAAAASHLNLDALREVLECPICMESFTEEQLRPKLLHCGHTICRQCLEKLLASSINGVRCPFCSKITRI
TSLTQLTDNLTVLKIIDTAGLSEAVGLLMCRSCGRRLPRQFCRSCGLVLCEPCREADHQPPGHCTLPVKE
AAEERRRDFGEKLTRLRELMGELQRRKAALEGVSKDLQARYKAVLQEYGHEERRVQDELARSRKFFTGSL
AEVEKSNSQVVEEQSYLLNIAEVQAVSRCDYFLAKIKQADVALLEETADEEEPELTASLPRELTLQDVEL
LKVGHVGPLQIGQAVKKPRTVNVEDSWAMEATASAASTSVTFREMDMSPEEVVASPRASPAKQRGPEAAS
NIQQCLFLKKMGAKGSTPGMFNLPVSLYVTSQGEVLVADRGNYRIQVFTRKGFLKEIRRSPSGIDSFVLS
FLGADLPNLTPLSVAMNCQGLIGVTDSYDNSLKVYTLDGHCVACHRSQLSKPWGITALPSGQFVVTDVEG
GKLWCFTVDRGSGVVKYSCLCSAVRPKFVTCDAEGTVYFTQGLGLNLENRQNEHHLEGGFSIGSVGPDGQ
LGRQISHFFSENEDFRCIAGMCVDARGDLIVADSSRKEILHFPKGGGYSVLIREGLTCPVGIALTPKGQL
LVLDCWDHCIKIYSYHLRRYSTP

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 71.8 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_036342
Locus ID 22954
UniProt ID Q13049
Cytogenetics 9q33.1
RefSeq Size 3734
RefSeq ORF 1959
Synonyms BBS11; HT2A; LGMD2H; LGMDR8; TATIP
Summary The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies. The protein has also been localized to the nucleus, where it interacts with the activation domain of the HIV-1 Tat protein. The Tat protein activates transcription of HIV-1 genes. [provided by RefSeq, Jul 2008]
Protein Families Transcription Factors
Protein Pathways Ubiquitin mediated proteolysis
Write Your Own Review
You're reviewing:TRIM32 (NM_012210) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301289 TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_036342) 10 ug
$3,255.00
PH323796 TRIM32 MS Standard C13 and N15-labeled recombinant protein (NP_001093149) 10 ug
$3,255.00
LC402167 TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC420491 TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC426077 TRIM32 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402167 Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 1 100 ug
$436.00
LY420491 Transient overexpression lysate of tripartite motif-containing 32 (TRIM32), transcript variant 2 100 ug
$665.00
TP323796 Purified recombinant protein of Homo sapiens tripartite motif-containing 32 (TRIM32), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.