HIGD2A (NM_138820) Human Recombinant Protein

SKU TP301223

Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), 20 µg

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201223 protein sequence; Red=Cloning site Green=Tags(s); ; MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG; NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP; ; myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 11.3 kDa
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_620175
• Locus ID: 192286
• UniProt ID: Q9BW72
• Cytogenetics: 5q35.2
• RefSeq Size: 628
• RefSeq ORF: 318
• Synonyms: RCF1b
• Summary: The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]
• Protein Families: Transmembrane