HIGD2A (NM_138820) Human Mass Spec Standard

SKU PH301223

HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC201223]
• Predicted MW: 11.5 kDa
• Protein Sequence:
  Protein Sequence

  >RC201223 protein sequence; Red=Cloning site Green=Tags(s); ; MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG; NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_620175
• RefSeq Size: 628
• RefSeq ORF: 318
• Synonyms: RCF1b
• Locus ID: 192286
• UniProt ID: Q9BW72
• Cytogenetics: 5q35.2
• Summary: The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. [provided by RefSeq, Sep 2016]
• Protein Families: Transmembrane