OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

HIGD2A (NM_138820) Human Mass Spec Standard

Be the first to review this product
SKU
PH301223
HIGD2A MS Standard C13 and N15-labeled recombinant protein (NP_620175)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA320133 Rabbit Polyclonal HIG2 Antibody
100 ug
$640.00
LY408465 Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) (as WB positive control) 100 ug
$436.00

Other products for "HIGD2A or NM_138820"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC201223
Predicted MW 11.5 kDa
Protein Sequence
Protein Sequence
>RC201223 protein sequence
Red=Cloning site Green=Tags(s)

MATPGPVIPEVPFEPSKPPVIEGLSPTVYRNPESFKEKFVRKTRENPVVPIGCLATAAALTYGLYSFHRG
NSQRSQLMMRTRIAAQGFTVAAILLGLAVTAMKSRP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_620175
RefSeq Size 628
RefSeq ORF 318
Synonyms RCF1b
Locus ID 192286
UniProt ID Q9BW72
Cytogenetics 5q35.2
Summary The protein encoded by this gene is a subunit of the cytochrome c oxidase complex (complex IV), which is the terminal enzyme in the mitochondrial respiratory chain. The encoded protein is an inner mitochondrial membrane protein and is a functional ortholog of the yeast respiratory supercomplex factor 1 (Rcf1). In mouse, the orthologous protein enhances cell survival under conditions of hypoxia. provided by RefSeq, Sep 2016
Protein Families Transmembrane
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "HIGD2A" proteins (3)
SKU Description Size Price
LC408465 Lyophilized HIGD2A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY408465 Transient overexpression lysate of HIG1 hypoxia inducible domain family, member 2A (HIGD2A) (as WB positive control) 100 ug
$436.00
TP301223 Recombinant protein of human HIG1 hypoxia inducible domain family, member 2A (HIGD2A), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products