MNK1 (MKNK1) (NM_003684) Human Recombinant Protein

SKU
TP301149
Recombinant protein of human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 20 µg
  • MVPro

    Full-length human proteins expressed in HEK293T cells

$867.00
In Stock*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Species Human
Expression Host HEK293T
Expression cDNA Clone or AA Sequence
Protein Sequence
>RC201149 protein sequence
Red=Cloning site Green=Tags(s)

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL

myc-FLAG tag
Tag C-Myc/DDK
Predicted MW 51.2 kDa
Concentration >0.05 µg/µL as determined by microplate BCA method
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
Preparation Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Note For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
Storage Store at -80°C.
Stability Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Shipping Dry Ice
Reference Data
RefSeq NP_003675
Locus ID 8569
UniProt ID Q9BUB5
Cytogenetics 1p33
RefSeq Size 2827
RefSeq ORF 1395
Synonyms MNK1
Summary This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Insulin signaling pathway, MAPK signaling pathway
Write Your Own Review
You're reviewing:MNK1 (MKNK1) (NM_003684) Human Recombinant Protein
Your Rating
SKU Description Size Price
PH301149 MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675) 10 ug
$3,255.00
LC404698 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418502 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427613 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404698 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2 100 ug
$436.00
LY418502 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1 100 ug
$436.00
LY427613 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3 100 ug
$436.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.