MNK1 (MKNK1) (NM_003684) Human Mass Spec Standard

SKU
PH301149
MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC201149]
Predicted MW 51.3 kDa
Protein Sequence
Protein Sequence
>RC201149 protein sequence
Red=Cloning site Green=Tags(s)

MVSSQKLEKPIEMGSSEPLPIADGDRRRKKKRRGRATDSLPGKFEDMYKLTSELLGEGAYAKVQGAVSLQ
NGKEYAVKIIEKQAGHSRSRVFREVETLYQCQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQK
HFNEREASRVVRDVAAALDFLHTKDKVSLCHLGWSAMAPSGLTAAPTSLGSSDPPTSASQVAGTTGIAHR
DLKPENILCESPEKVSPVKICDFDLGSGMKLNNSCTPITTPELTTPCGSAEYMAPEVVEVFTDQATFYDK
RCDLWSLGVVLYIMLSGYPPFVGHCGADCGWDRGEVCRVCQNKLFESIQEGKYEFPDKDWAHISSEAKDL
ISKLLVRDAKQRLSAAQVLQHPWVQGQAPEKGLPTPQVLQRNSSTMDLTLFAAEAIALNRQLSQHEENEL
AEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTAL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003675
RefSeq Size 2827
RefSeq ORF 1395
Synonyms MNK1
Locus ID 8569
UniProt ID Q9BUB5
Cytogenetics 1p33
Summary This gene encodes a Ser/Thr protein kinase that interacts with, and is activated by ERK1 and p38 mitogen-activated protein kinases, and thus may play a role in the response to environmental stress and cytokines. This kinase may also regulate transcription by phosphorylating eIF4E via interaction with the C-terminal region of eIF4G. Alternatively spliced transcript variants have been noted for this gene. [provided by RefSeq, Jan 2012]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Insulin signaling pathway, MAPK signaling pathway
Write Your Own Review
You're reviewing:MNK1 (MKNK1) (NM_003684) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC404698 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418502 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427613 MKNK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY404698 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2 100 ug
$436.00
LY418502 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1 100 ug
$436.00
LY427613 Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3 100 ug
$436.00
TP301149 Recombinant protein of human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.